A practical reference on AOD-9604: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-07-02. Anything still debated is marked as such rather than presented as settled.
In laboratory settings, AOD-9604 is commonly supplied as a lyophilized powder and stored cold to limit degradation. Reconstituted solutions are typically kept refrigerated or frozen, depending on the buffer and concentration, and protected from repeated freeze-thaw cycles. Stability can be influenced by pH, temperature, and the presence of proteases. Purity is usually assessed by high-performance liquid chromatography and mass spectrometry. These practices support reproducibility, but they do not imply safety or efficacy for any human use.
Regulatory status: AOD-9604 is not approved as a therapeutic drug in the United States, European Union, or other major markets. It is listed by the World Anti-Doping Agency as a prohibited substance in sport, specifically under growth hormone fragments. Many jurisdictions restrict its sale for human consumption. Products marketed online may not meet pharmaceutical quality standards. The legal status varies by country and often depends on whether the material is presented as a research chemical, supplement, or drug.
Detection and characterization of AOD-9604 in research and anti-doping settings typically rely on mass spectrometry coupled with liquid chromatography. These methods can identify the peptide by its mass and fragmentation pattern. Immunoassays may also be used in some screening contexts, but they can cross-react with related peptides. Because the molecule is small and may be present at low concentrations, sample preparation and method validation are important. Confirmatory analysis usually requires comparison with a certified reference standard.
Development of AOD-9604 began in the 1990s as scientists sought to isolate metabolic effects of growth hormone without its growth-promoting actions. Early laboratory work focused on fat cells and animal models. Several human trials followed, examining changes in body composition and fat mass. Results have been mixed, and the peptide has not progressed to widespread clinical approval. Interest continues in research settings, particularly regarding its mechanism and potential metabolic targets.
Regulatory status varies by country. In the United States, AOD-9604 is not approved as a prescription drug. It is sometimes sold as a research chemical or dietary supplement, though such marketing may fall outside legal frameworks. The World Anti-Doping Agency prohibits its use in sport. Researchers must obtain it through legitimate suppliers and follow institutional rules. Its legal classification continues to evolve as authorities increasingly assess peptide products more broadly.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Not approved as a medicine | Status varies by country; prohibited in sport. |
| Common storage temperature | 2–8 °C for lyophilized powder | Protect from light and moisture; follow supplier instructions. |
| Typical analytical method | LC-MS/MS | Used for identification and quantification in biological samples. |
| Purity assessment | HPLC and mass spectrometry | Reverse-phase HPLC is common for peptide purity. |
| Common synonyms | AOD9604; hGH 176-191 fragment | Naming conventions differ across studies. |
AOD9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It corresponds to a short sequence near the end of the 191-amino-acid hormone, often described as residues 176–191 or a related fragment. Researchers designed it to separate metabolic effects from the growth-promoting actions of full-length growth hormone. Early work in the 1990s explored it as a candidate for weight and lipid disorders. It is not a naturally circulating hormone fragment produced in large amounts.
Laboratory studies have reported that AOD9604 can increase lipolysis and reduce lipid accumulation in fat cells. The precise molecular target remains uncertain, and the compound does not appear to activate the growth hormone receptor in the same way as full-length hGH. Proposed mechanisms include effects on beta-adrenergic signaling and enzymes involved in fatty acid synthesis, but these pathways are not firmly established. Because most evidence comes from cell and animal models, whether the same effects occur in humans is an open question.
The compound has been studied as a potential treatment for obesity and related metabolic conditions. Published trials have examined changes in body weight, fat mass, and safety markers over limited durations. Results have been mixed or modest, and no large-scale outcome trials are established. Regulatory agencies in several countries have not approved it as a therapeutic drug. Some commercial products have been marketed outside regulated pharmaceutical channels, which raises questions about quality and claims.
In the scientific literature, AOD-9604 appears in reviews of growth hormone fragments and in discussions of peptide-based metabolic research. Some sources distinguish it from growth hormone itself, while others group it with compounds marketed for weight management. The evidence base is small compared with approved obesity medications. Questions about long-term efficacy and clinical relevance remain open, and independent replication of key findings is limited. Most published reports are early-stage and exploratory.
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It is often described as hGH fragment 176-191. Research interest arose because it was designed to isolate possible effects on fat metabolism from other actions of growth hormone. It is not a full growth hormone molecule. Its development history includes early laboratory and animal studies followed by human trials. The peptide has been examined in laboratory, animal, and limited human studies.
Annex 13 of the Chicago Convention provides the international Standards And Recommended Practices that form the basis for air accident and incident investigations by signatory countries, as well as reporting and preventive measures. The International Civil Aviation Organization (ICAO) is specifically focused on preventing accidents, rather than determining liability. In Australia, the Australian Transport Safety Bureau is the federal government body responsible for investigating transport-related accidents and incidents, covering air, sea, and rail travel. Formerly an agency of the Department of Infrastructure, Transport, Regional Development and Local Government, in 2010, in the interests of keeping its independence it became a stand-alone agency.
Whey protein contains high levels of all the essential amino acids and branched-chain amino acids. It also has the highest content of the amino acid cysteine, which aids in the biosynthesis of glutathione. For bodybuilders, whey protein provides amino acids used to aid in muscle recovery. Whey protein is derived from the process of making cheese from milk. There are three types of whey protein: whey concentrate, whey isolate, and whey hydrolysate. Whey concentrate is 29–89% protein by weight whereas whey isolate is 90%+ protein by weight. Whey hydrolysate is enzymatically predigested and therefore has the highest rate of digestion of all protein types. Casein protein (or milk protein) has glutamine, and casomorphin. Some nutritionists have suggested that higher calcium excretion may be due to a corresponding increase in protein-induced calcium absorption in the intestines. Some bodybuilders believe that amino acid supplements may benefit muscle development, but consumption of such supplements is unnecessary in a diet that already includes adequate protein intake.
Agonists PACAP-38 (endogenous peptide agonist, full length version) - also activates other receptors VIP, GPR55 and MRGPRX2 and the Secretin receptor. PACAP-27 (endogenous peptide agonist, shorter fragment which retains activity) Antagonists PACAP(6-38) - N-terminal truncated version of the endogenous peptide agonist which acts as a potent PAC1 antagonist BAY 2686013 PA-915 "VIP and PACAP Receptors: PAC1". IUPHAR Database of Receptors and Ion Channels. International Union of Basic and Clinical Pharmacology. Human ADCYAP1R1 genome location and ADCYAP1R1 gene details page in the UCSC Genome Browser. This article incorporates text from the United States National Library of Medicine, which is in the public domain.
25499Es + 4820Ca → 302119Uue* → no atoms It is highly unlikely that this reaction will be able to create any atoms of ununennium in the near future, given the extremely difficult task of making sufficient amounts of einsteinium-254, which is favoured for production of ultraheavy elements because of its large mass, relatively long half-life of 270 days, and availability in significant amounts of several micrograms, to make a large enough target to increase the sensitivity of the experiment to the required level; einsteinium has not been found in nature and has only been produced in laboratories, and in quantities smaller than those needed for effective synthesis of superheavy elements. However, given that ununennium is only the first period 8 element on the extended periodic table, it may well be discovered in the near future through other reactions, and indeed an attempt to synthesise it is currently ongoing in Japan. Currently, none of the period 8 elements has been discovered yet, and it is also possible, due to drip instabilities, that only the lower period 8 elements, up to around element 128, are physically possible. No attempts at synthesis have been made for any heavier alkali metals: due to their extremely high atomic number, they would require new, more powerful methods and technology to make.
Sources: en.wikipedia.org
Amivantamab, sold under the brand name Rybrevant, is a bispecific monoclonal antibody used to treat non-small cell lung cancer. Amivantamab is a bispecific epidermal growth factor (EGF) receptor-directed and MET receptor-directed antibody. It is the first treatment for adults with non-small cell lung cancer whose tumors have specific types of genetic mutations: epidermal growth factor receptor (EGFR) exon 20 insertion mutations. The most common side effects include rash, infusion-related reactions, skin infections around the fingernails or toenails, muscle and joint pain, shortness of breath, nausea, fatigue, swelling in the lower legs or hands or face, sores in the mouth, cough, constipation, vomiting and changes in certain blood tests. Amivantamab was approved for medical use in the United States in May 2021, and in the European Union in December 2021. The US Food and Drug Administration considers it to be a first-in-class medication.
Enteroglucagon is a proglucagon-derived peptide or enteroendocrine cells derived peptide in the small intestine. Preproglucagon undergoes post translational modification to release glucagon-like peptides (GLP-1 and GLP-2) and other molecules derived from L-cells of intestine. GLP-1 is derived from a class of intestinal hormones called incretin and the molecule exists in two forms GLP-1(7-37) and GLP-1(7-36) amide. GLP-1 form of incretin starts circulating in response to a high blood glucose level. Incretin effect is a negative feedback loop between glucose and insulin level, it promotes insulin release from beta cells of pancreas islet and suppresses glucagon when the glucose level is high. In vertebrate mammals, GLP-2 sequences are highly conversed in the intestine. The molecule functions as a part of adaptive response, such that contributes intestinal growth, proliferation effect, intestinal dilation (increases the mucosal blood flow) and reduces the chance of apoptosis.
Receptors bind with endogenous ligands to produce a physiological effect and regulate the body and cellular homeostasis. In a ligand-receptor interaction, the ligand binds with the receptors to form a drug-receptor complex, producing a biological response. The biological nature of receptors can be enzymes, nucleic acids or cellular proteins. Common types of receptors include G-protein coupled receptors, nuclear receptors and ion channels. Functional antagonists would not produce a biological response after binding with a receptor. It blocks the binding of endogenous ligands to the receptors and thus inhibits the subsequent physiological effect.
Sources: en.wikipedia.org
At low concentrations of TNP-ATP (≤1 μM), fluorescent intensity is proportional to the concentration of TNP added. However, at concentrations exceeding 1 μM, inner filter effects cause this relationship to no longer be linear. To correct this, researchers must determine the ratio of the predicted theoretical fluorescence intensity (assuming linearity) to the observed fluorescence intensity and then apply this correction factor. However, in most cases, researchers will try to keep the concentration of TNP to lower than 1 μM. To determine binding affinities, TNP-ATP is added to a solution and then titrated with protein. This produces a saturation curve from which the binding affinity can be determined. The number of binding sites may also be determined through this saturation curve by looking to see if there are sudden changes in slope. One can also titrate a fixed amount of protein with increasing additions of TNP-ATP to obtain a saturation curve. To do so, however, may get complicated due to the inner filter effects that will need to be corrected for. To determine dissociation constants, TNP-ATP can be competed off of a protein with ATP. The value of the dissociation constant Kd for a single-site binding can then be obtained by applying the Langmuir equation for a curve fit:
Anne-Claude Gingras is a senior investigator at Lunenfeld-Tanenbaum Research Institute, and a professor in the department of molecular genetics at the University of Toronto. She is an expert in mass spectrometry based proteomics technology that allows identification and quantification of protein from various biological samples. Gingras was born on Île d'Orléans, Quebec. She earned her undergraduate degree at Université Laval in Quebec. She completed her PhD in biochemistry at McGill University in Montreal, studying how 4E-BP1 regulated translation initiation, under the mentorship of Nahum Sonenberg. After graduating in 2001, she began postdoctoral research in Seattle at the Institute for Systems Biology in the lab of Ruedi Aebersold, where she studied proteomics for three years. In 2005, Gingras moved to Toronto and joined the Lunenfeld-Tanenbaum Research Institute, and in 2006, she began teaching at the University of Toronto in the department of molecular genetics.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Antidotes can be employed to either mop up hazardous metabolites or change them into less toxic forms once they have developed. Hepatic glutathione stores are replenished by N-acetyl cysteine, and this process is what leads to the conjugation of the poisonous metabolite N-acetyl P-benzoquinone imine (NAPQI). Receptor antagonist Receptor Dose–response relationship Pharmacodynamics Antidotes
Sources: en.wikipedia.org
No major regulatory agency has approved AOD-9604 as a medicine. It is treated as an experimental peptide in research settings. Some countries restrict its sale or import.
The World Anti-Doping Agency classifies growth hormone fragments, including AOD-9604, as prohibited substances. The classification reflects concern about potential performance-enhancing use. Athletes are subject to testing for such peptides.
Detection typically uses liquid chromatography combined with mass spectrometry. These methods separate the peptide and identify it by mass. Immunoassays may screen samples but require confirmation by a more specific technique.
AOD-9604 is a synthetic peptide fragment of human growth hormone, corresponding to amino acids 176-191. It is studied for potential effects on fat metabolism, but it is not approved as a drug in most countries. Its exact mechanism remains under investigation.