anti-doping raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2025-10-27. Anything still debated is marked as such rather than presented as settled.
Research on AOD-9604 also examines how the peptide is measured in biological samples. Analytical methods may include liquid chromatography coupled with mass spectrometry, immunoassays, or both. Detection can be challenging because the peptide is small and may be present at low concentrations. Published methods vary in sensitivity and specificity, so comparative interpretation requires attention to validation details. The presence of related hGH fragments can complicate identification in some matrices.
AOD-9604 has been investigated mainly in the context of body fat and metabolic endpoints. Some early animal and small human studies reported changes in fat mass or lipid markers, but findings were not uniform. Larger, well-controlled trials that would establish efficacy are lacking in the public literature. As a result, claims about weight loss or metabolic benefit remain investigational rather than established. The distinction between a research finding and a proven clinical outcome is central to discussing this peptide.
Regulatory bodies have taken different approaches to AOD-9604. It is not approved as a prescription medicine by major agencies such as the U.S. Food and Drug Administration or the European Medicines Agency. In sport, the World Anti-Doping Agency prohibits peptide hormones, growth factors, and related substances, and AOD-9604 has been treated as a prohibited substance. These regulatory decisions reflect concerns about safety, efficacy, and potential misuse rather than proof of benefit.
In laboratory settings, AOD-9604 is commonly supplied as a lyophilized powder and stored cold to limit degradation. Reconstituted solutions are typically kept refrigerated or frozen, depending on the buffer and concentration, and protected from repeated freeze-thaw cycles. Stability can be influenced by pH, temperature, and the presence of proteases. Purity is usually assessed by high-performance liquid chromatography and mass spectrometry. These practices support reproducibility, but they do not imply safety or efficacy for any human use.
Regulatory status: AOD-9604 is not approved as a therapeutic drug in the United States, European Union, or other major markets. It is listed by the World Anti-Doping Agency as a prohibited substance in sport, specifically under growth hormone fragments. Many jurisdictions restrict its sale for human consumption. Products marketed online may not meet pharmaceutical quality standards. The legal status varies by country and often depends on whether the material is presented as a research chemical, supplement, or drug.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Not approved as a medicine | Major agencies have not authorized it for therapeutic use. |
| Anti-doping status | Prohibited in sport | Listed among peptide hormones and related substances. |
| Primary research area | Metabolic and body-composition effects | Studies often examine fat mass or lipid markers. |
| Human evidence | Limited and mixed | Public data do not establish clinical efficacy. |
| Analytical detection | LC-MS and immunoassays | Methods vary in sensitivity and validation. |
Regulatory status varies by country. In the United States, AOD-9604 is not approved as a prescription drug. It is sometimes sold as a research chemical or dietary supplement, though such marketing may fall outside legal frameworks. The World Anti-Doping Agency prohibits its use in sport. Researchers must obtain it through legitimate suppliers and follow institutional rules. Its legal classification continues to evolve as authorities increasingly assess peptide products more broadly.
AOD-9604 is a synthetic peptide whose sequence matches the C-terminal fragment of human growth hormone, specifically residues 176 through 191. This region differs from the full hormone in its receptor interactions. The peptide is not a growth hormone secretagogue and does not bind the growth hormone receptor in the same manner. Researchers have examined it for effects on lipid metabolism, but its exact pharmacological profile remains an active area of study.
Development of AOD-9604 began in the 1990s as scientists sought to isolate metabolic effects of growth hormone without its growth-promoting actions. Early laboratory work focused on fat cells and animal models. Several human trials followed, examining changes in body composition and fat mass. Results have been mixed, and the peptide has not progressed to widespread clinical approval. Interest continues in research settings, particularly regarding its mechanism and potential metabolic targets.
Laboratory studies have reported that AOD9604 can increase lipolysis and reduce lipid accumulation in fat cells. The precise molecular target remains uncertain, and the compound does not appear to activate the growth hormone receptor in the same way as full-length hGH. Proposed mechanisms include effects on beta-adrenergic signaling and enzymes involved in fatty acid synthesis, but these pathways are not firmly established. Because most evidence comes from cell and animal models, whether the same effects occur in humans is an open question.
Clinical development of AOD9604 included trials in people with obesity, but the results did not lead to approval as a prescription medicine in major markets. Interest later shifted to research settings and to unapproved products marketed for body composition. Regulatory agencies have questioned whether the peptide qualifies as a dietary ingredient, and some have issued warnings about its presence in supplements. Long-term human safety data are limited, and questions about efficacy, dosing, and target populations remain unresolved.
AOD9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It corresponds to a short sequence near the end of the 191-amino-acid hormone, often described as residues 176–191 or a related fragment. Researchers designed it to separate metabolic effects from the growth-promoting actions of full-length growth hormone. Early work in the 1990s explored it as a candidate for weight and lipid disorders. It is not a naturally circulating hormone fragment produced in large amounts.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
== Recent research == Recent research has been directed towards finding better treatment options. Multi-drug therapy using insulin sensitizers, such as metformin and pioglitazone, has been linked to improving residual insulin action. High doses of insulin-like growth factor 1 has also been effective in patients with Rabson–Mendenhall syndrome. Though there is no cure, researchers remain optimistic on finding a cure.
== Pathogenesis == It is unclear precisely how statins lead to statin-associated autoimmune myopathy. The disorder is positively associated with HLA-DR11 and the DRB1*11:01 allele. There are likely other unidentified genetic and environmental risk factors associated with SAAM, given the prevalence of the DRB1 allele and the low incidence of autoimmunity in that group. Statins inhibit HMG-CoA reductase activity and consequently lower cholesterol levels in the blood. However, by doing this, they also increase the production of the HMG-CoA reductase protein. SAAM hypothetically triggers this increase in the production of HMG-CoA reductase and associated abnormal processing of this protein in genetically susceptible individuals. This abnormal processing theoretically triggers the generation of antibodies targeting the HMG-CoA reductase protein resulting in SAAM. Another theory postulates that the configuration of the HMG-CoA reductase protein may change when statin medications bind to it causing the protein to expose certain antigens that the immune system is not tolerant to resulting in the production of antibodies against it.
Radiology ( RAY-dee-OL-ə-jee) is the medical specialty that uses medical imaging to diagnose diseases and guide treatment within the bodies of humans and other animals. It began with radiography (which is why its name has a root referring to radiation), but today it includes all imaging modalities. This includes technologies that use non-ionizing acoustic or electromagnetic radiation, such as ultrasonography and magnetic resonance imaging (MRI), as well as others that do use ionizing radiation, such as computed tomography (CT), fluoroscopy, and nuclear medicine including positron emission tomography (PET). Interventional radiology is the performance of usually minimally invasive medical procedures with the guidance of imaging technologies such as those mentioned above. The modern practice of radiology involves a team of several different healthcare professionals. A radiologist, who is a medical doctor with specialized post-graduate training, interprets medical images, communicates these findings to other physicians through reports or verbal communication, and uses imaging to perform minimally invasive medical procedures The nurse is involved in the care of patients before and after imaging or procedures, including administration of medications, monitoring of vital signs and monitoring of sedated patients. The radiographer, also known as a radiologic technologist in countries such as the United States and Canada, is a specialized healthcare professional who performs radiographic procedures and radiation therapy for the diagnosis and treatment of diseases such as cancer.
=== Clinical significance === Interstitial deletions of chromosome 3 are rare, and only a few patients with a microdeletion of 3p21.31 have been reported to date. Characteristic clinical features found in patients with a microdeletion of 3p21.31 include developmental delay and distinctive facial features (including arched eyebrows, hypertelorism, epicanthus, and micrognathia). In the gene region, NCBI SNP identified 1,326 SNPS on the reverse minus strand of C3orf62. In the coding region, NCBI SNP identified 147 common SNPs.
Sources: en.wikipedia.org
Chairman Mao Zedong and his People's Republic of China founded in 1949 was critical of Han chauvinism. In the latter half of the 20th century, official policy of communist China marked Han chauvinism as anti-Marxist. Today, the tension between the dominant Han Chinese majority and ethnic minorities remains contentious, as the deterioration in ethnic relations has compounded by China's contemporary ethnic policies in favor of ethnic minorities since its founding. Han chauvinism has been gaining mainstream popularity throughout China since the 2000s, attributed to discontent toward these ethnic policies instituted by the Chinese government. The contemporary dissatisfaction and discord between the dominant Han Chinese mainstream and its non-Han minorities has led to the Chinese government scaling back on preferential treatment for ethnic minorities under the general secretaryship of Xi Jinping.
==== Alloys ==== Due to the presence of valence 5f electrons, neptunium and its alloys exhibit a very interesting magnetic behavior, like many other actinides. These can range from the itinerant band-like character characteristic of the transition metals to the local moment behavior typical of scandium, yttrium, and the lanthanides. This stems from 5f-orbital hybridization with the orbitals of the metal ligands, and the fact that the 5f orbital is relativistically destabilized and extends outwards. For example, pure neptunium is paramagnetic, NpAl3 is ferromagnetic, NpGe3 has no magnetic ordering, and NpSn3 may be a heavy fermion material. Investigations are underway regarding alloys of neptunium with uranium, americium, plutonium, zirconium, and iron, so as to recycle long-lived waste isotopes such as neptunium-237 into shorter-lived isotopes more useful as nuclear fuel. One neptunium-based superconductor alloy has been discovered with formula NpPd5Al2. This occurrence in neptunium compounds is somewhat surprising because they often exhibit strong magnetism, which usually destroys superconductivity. The alloy has a tetragonal structure with a superconductivity transition temperature of −268.3 °C (4.9 K).
Psychiatric disturbances: anxiety CNS reactions: somnolence, malaise, vertigo, paresthesia, headache, apathy Ear problems: hearing loss Heart problems: tachycardia GI reactions: xerostomia, taste disorders, diarrhoea, dyspepsia, upper quadrant pain, lip paresthesia, nausea, vomiting, constipation, excessive thirst Hepatic and bile ducts reactions: hepatic insufficiency, hepatitis, increased liver enzymes Skin and soft tissue reactions: rash, pruritus, urticaria, flushing, blistering, lumps, exudation, erythema multiforme Renal reactions: urinary retention Reproductive system reactions: dysmenorrhoea, mastitis, gynecomastia in males, breast pain
==== Active sensor methodologies ==== Satellite RADAR mapping is one of the major techniques of generating Digital Elevation Models (see below). Similar techniques are applied in bathymetric surveys using sonar to determine the terrain of the ocean floor. In recent years, lidar, a remote sensing technique that uses a laser instead of radio waves, has increasingly been employed for complex mapping needs such as charting canopies and monitoring glaciers.
=== Pyrethroids === Pyrethroid insecticides mimic the insecticidal activity of the natural compound pyrethrin, the biopesticide found in Pyrethrum (Now Chrysanthemum and Tanacetum) species. They have been modified to increase their stability in the environment. These compounds are nonpersistent sodium channel modulators and are less toxic than organophosphates and carbamates. Compounds in this group are often applied against household pests. Some synthetic pyrethroids are toxic to the nervous system.
Sources: en.wikipedia.org
== Changes for 2020 exam == The Central Board of Secondary Education (CBSE) has been conducting two separate Mathematics examinations in the class 10 board examination, starting from the 2020 session. Mathematics exam till 2019 was Mathematics (Standard), and an easier version, Mathematics (Basic), has been introduced. The option to choose mathematics is available on the registration form for the Class 10 CBSE board examination. Candidates are required to select their test choice while filling out the registration form for the CBSE Class 10 board examination 2020. Minister of Education, MoE (previously Minister of Human Resource Department, HRD), amid the coronavirus outbreak had ordered rescheduling of pending examinations. The exams rescheduled were to be conducted between 1 and 15 July. On 26 June, CBSE released as circular which cancelled the remaining exams and give scores based on the scores of the exams already taken by students. Some students of Delhi who were able to provide three or fewer exams were scored as per their performance in internal exams. This decision came after a judicial ruling.
Organomagnesium compounds are widespread in organic chemistry. They are commonly found as Grignard reagents, formed by reaction of magnesium with haloalkanes or aryl halides in diethyl ether. Examples of Grignard reagents are phenylmagnesium bromide and ethylmagnesium bromide. The Grignard reagents function as a common nucleophile, attacking the electrophilic group such as the carbon atom that is present within the polar bond of a carbonyl group. A prominent organomagnesium reagent beyond Grignard reagents is magnesium anthracene or magnesocene, which is used as a source of highly active magnesium. First prepared in 1954 by independent groups, one led by Ernst Otto Fischer, the other by Albert Wilkinson, magnesocene is a white to off-yellow pyrophoric powder that violently hydrolyses in water. The related butadiene-magnesium adduct serves as a source for the butadiene dianion. Complexes of dimagnesium(I) have been observed.
== In HIV infection and immunosuppression == The suppression of CD4 T cells by HIV (or by immunosuppressive drugs) causes a decrease in the body's normal response to certain infections. Not only does this make it more difficult to fight the infection, it may mean that a level of infection that would normally produce symptoms is instead undetected (subclinical infection). If the CD4 count rapidly increases (due to effective treatment of HIV, or removal of other causes of immunosuppression), a sudden increase in the inflammatory response produces nonspecific symptoms such as fever, and in some cases a worsening of damage to the infected tissue. Though these symptoms can be dangerous, they also indicate that the body may now have a better chance to defeat the infection. The best treatment for this condition is unknown. In paradoxical IRIS reactions, the events will usually spontaneously get better with time without any additional therapy. In unmasking IRIS, the most common treatment is to administer antibiotic or antiviral drugs against the infectious organism. In some severe cases, anti-inflammatory medications, such as corticosteroids are needed to suppress inflammation until the infection has been eliminated. Infections most commonly associated with IRIS include Mycobacterium tuberculosis and cryptococcal meningitis. Persons living with AIDS are more at risk for IRIS if they are starting HAARTTooltip HAART for the first time, or if they have recently been treated for an opportunistic infection (OI).
Recent data have shown that astrocytes, but not neurons, possess the mitochondrial enzymes needed to metabolize fatty acids, and that the resulting oxidative stress can damage mitochondria. Thus, an increased uptake and oxidation of fatty acids in glia containing FABP7 is likely to cause the oxidative stress and damage to mitochondria in these cells. Also, FABP proteins have recently been shown to interact with a protein called synuclein to cause mitochondrial damage.
Sources: en.wikipedia.org
No. It is not approved as a therapeutic drug by major regulators. It is sold for research purposes in many settings, which is not the same as clinical approval.
It is classified among peptide hormones and related substances that are prohibited in sport. The ban reflects anti-doping rules rather than a judgment that the peptide is effective for performance enhancement.
Human studies are limited and have not produced consistent evidence of meaningful clinical benefit. Some early trials examined metabolic endpoints, but larger confirmatory trials are generally lacking.
No major regulatory agency has approved AOD-9604 as a medicine. It is treated as an experimental peptide in research settings. Some countries restrict its sale or import.