A practical reference on AOD-9604: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-06-04. Anything still debated is marked as such rather than presented as settled.
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It corresponds to residues 176-191 of the 191-amino-acid hGH sequence. The fragment is not the full hormone and lacks the receptor-binding region associated with growth and metabolic effects of hGH. Researchers developed it to isolate a specific portion of hGH for study. Its exact sequence and length are often stated in peptide catalogs and patents.
The peptide is frequently described as a growth hormone fragment, although it is chemically distinct from full-length hGH. AOD-9604 contains 16 amino acids and includes two cysteine residues that can form an intramolecular disulfide bond. In solution, this structural feature can influence folding, aggregation, and stability. Published descriptions sometimes call it hGH 176-191 or AOD9604, with spacing and capitalization varying. Such naming differences can complicate literature searches, database entries, and product verification.
Researchers have studied the fragment in cell and animal models to understand its metabolic actions. Some experiments report effects on fat breakdown and fat storage pathways, but the underlying mechanism remains incompletely defined. AOD-9604 does not appear to stimulate the same broad growth hormone receptor signaling as full-length hGH. Whether its observed activities arise from direct receptor interactions or downstream metabolic changes is an open question. Results from different assays are not always consistent.
AOD-9604 is a synthetic peptide whose structure corresponds to a C-terminal segment of human growth hormone. It is often described as hGH fragment 176-191, a 16-amino-acid sequence. The peptide was designed to isolate a region of hGH associated with fat metabolism while avoiding the full hormone's growth-promoting actions. Laboratory and commercial materials typically present it as a lyophilized powder for research use. Its identity is defined by amino acid sequence, not by a single brand.
The fragment includes residues that can form an internal disulfide bond between two cysteine positions. This structural feature can influence how the peptide folds and how stable it is in solution. AOD-9604 differs from full-length hGH in size and receptor interactions; it does not contain the entire growth hormone sequence. Published descriptions sometimes use slightly different residue numbering, so sequence information should be checked against primary sources. The molecule is small compared with intact hGH, which affects analytical detection and purification approaches.
Interest in AOD-9604 arose from attempts to separate metabolic effects from growth effects attributed to hGH. Early work explored whether the fragment could influence lipolysis or fat oxidation without promoting growth. Those questions remain partly unresolved because human data are limited and results have varied across studies. The peptide is not a hormone replacement for hGH and is not equivalent to hGH in clinical use. Its research history includes both laboratory studies and commercial marketing claims that are not the same as regulatory approval.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Synthetic peptide | Derived from a fragment of human growth hormone |
| Sequence basis | hGH residues 176-191 | Commonly described as a 16-amino-acid fragment |
| Appearance | White to off-white powder | Typical for lyophilized research peptides |
| Solubility | Soluble in water or aqueous buffer | Exact solubility depends on pH and purity |
| Common synonyms | AOD9604; hGH 176-191 | Spelling and punctuation vary across sources |
The compound has been studied as a potential treatment for obesity and related metabolic conditions. Published trials have examined changes in body weight, fat mass, and safety markers over limited durations. Results have been mixed or modest, and no large-scale outcome trials are established. Regulatory agencies in several countries have not approved it as a therapeutic drug. Some commercial products have been marketed outside regulated pharmaceutical channels, which raises questions about quality and claims.
In the scientific literature, AOD-9604 appears in reviews of growth hormone fragments and in discussions of peptide-based metabolic research. Some sources distinguish it from growth hormone itself, while others group it with compounds marketed for weight management. The evidence base is small compared with approved obesity medications. Questions about long-term efficacy and clinical relevance remain open, and independent replication of key findings is limited. Most published reports are early-stage and exploratory.
AOD-9604 is listed as a prohibited substance in sport by the World Anti-Doping Agency. It falls under the peptide hormones, growth factors, related substances, and mimetics class on the prohibited list. Anti-doping organizations treat its presence in an athlete's sample as an adverse finding unless a therapeutic use exemption applies. The prohibition reflects concerns about performance enhancement in competitive settings and the difficulty of distinguishing exogenous peptide use from endogenous hormone fragments.
Detection of AOD-9604 in biological samples relies on analytical techniques capable of distinguishing a small synthetic peptide from related endogenous sequences. Liquid chromatography coupled with tandem mass spectrometry is commonly used for confirmatory analysis. Sample preparation may involve immunoaffinity enrichment or solid-phase extraction to concentrate the peptide. Because the molecule is small and may be present at low concentrations, assay sensitivity and specificity are ongoing analytical challenges. Laboratories also validate methods against reference materials when available.
Regulatory interest in AOD-9604 increased after high-profile anti-doping cases involving peptide products. In some cases, the substance was supplied under alternative names or in compounded preparations, complicating traceability. Sports tribunals and anti-doping panels have discussed whether the peptide was explicitly banned at the time of use, leading to clarifications by the World Anti-Doping Agency. For consumers and researchers, the legal status can vary by jurisdiction, and products marketed as research chemicals may lack independent quality verification.
The most common peptide aptamer selection system is the yeast two-hybrid system. Peptide aptamers can also be selected from combinatorial peptide libraries constructed by phage display and other surface display technologies such as mRNA display, ribosome display, bacterial display and yeast display. These experimental procedures are also known as biopanning. All the peptides panned from combinatorial peptide libraries have been stored in the MimoDB database.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
The effects are varied depending on the particular drug given. When anesthetists administer standard doses of these anesthetic drugs to a person with butyrylcholinesterase deficiency, the patient experiences prolonged paralysis of the respiratory muscles, requiring an extended period of time during which the patient must be mechanically ventilated. Eventually the muscle-paralyzing effects of these drugs will wear off despite the deficiency of the pseudocholinesterase enzyme. If the patient is maintained on a mechanical respirator until normal breathing function returns, there is little risk of harm to the patient. Because it is rare in the general population the deficiency is sometimes overlooked when a patient does not wake up after surgery. If this happens, there are two major complications that can arise. First, the patient may lie awake and paralyzed while medical providers try to determine the cause of the patient's unresponsiveness. Second, the breathing tube may be removed before the patient is strong enough to breathe properly, potentially causing respiratory arrest. This enzyme abnormality is a benign condition unless a person with burtyrylcholinesterase deficiency is exposed to the offending pharmacological agents.
Sources: en.wikipedia.org
On September 26, 2020, an event was held in the White House Rose Garden announcing Amy Coney Barrett's nomination to the Supreme Court following the death of Ruth Bader Ginsburg. According to a 2021 book by Trump's Chief of Staff Mark Meadows, hours after the ceremony, Trump tested positive for COVID-19, although a subsequent test returned negative. Meadows recalled that Trump looked "a little tired" and was suspected of having a "slight cold". Trump later traveled in Air Force One to a rally at the Harrisburg International Airport in Pennsylvania, which was attended by thousands. After Trump's diagnosis was made public, Pennsylvania health officials advised attendees to participate in the state's contact tracing program. After returning from Bedminster, Trump received a positive test result on a rapid test and was waiting to get results of a PCR test when he did a live phone interview on Hannity. On October 2, 2020, Trump tweeted that he and his wife Melania Trump had both tested positive for COVID-19, part of a White House outbreak. Later that day, Trump was hospitalized at Walter Reed National Military Medical Center, reportedly due to fever and labored breathing. He was treated with antivirals, an experimental antibody drug (REGN-COV2), and a steroid. He returned to the White House on October 5, still infectious and unwell. In 2021, it was revealed that his condition had been far more serious than he had previously indicated; he had dangerously low blood oxygen levels, a high fever, and lung infiltrates, indicating a severe case of COVID-19.
== Career == In 2001, Nigam founded the Swansea University Maggot Research Group, of which she is a director. The group focuses on therapeutic applications of the medicinal maggot Lucilia sericata. She then became an associate professor at Swansea University. In 2018, Nigam was promoted to professor which included a move from the research to the innovation and engagement strand. Nigam fulfills many roles outside of her permanent academic position. In 2007, she became a member of the Welsh Wound Network group, an enterprise which aims to support the clinical development of wound healing science. In April 2014, she was an elected participant of the Welsh Crucible Programme. Nigam is an elected Fellow of the Royal Entomological Society (FRES).
Placing a wedge in the felling cut can prevent a sitback from pinching the saw. Freeing: Working a badly fallen tree that may have become trapped in other trees. Working out maximum tension locations to decide the safest way to release tension, and a winch may be needed in complicated situations. To avoid cutting straight through a tree in tension, one or two cuts at the tension point of sufficient depth to reduce tension may be necessary. After tension releases, cuts are made outside the bend. Limbing: Cutting the branches off the log. The operator must be able to properly reach the cut to avoid kickback. Bucking: Cross-cutting the felled log into sections. Setup is made to avoid binding the chainsaw within the changing log tensions and compressions. Safe bucking is started at the log high-side and then sections worked offside, toward the butt end. The offside log falls and allows for gravity to help prevent binds. The log's kerf movement while cutting can help to indicate binds. Additional equipment (lifts, bars, wedges, and winches) and special cutting techniques can help prevent binds. Binds: This is when the chainsaw is at risk or is stuck in the log compression. A log bound chainsaw is unsafe and must be carefully removed to prevent equipment damage. Top bind – The tension area on log bottom, compression on top. Bottom bind – The tension area on log top, compression on bottom. Side bind – Sideways pressure exerted on the log. End bind – Weight compresses the log's entire cross-section.
There are 120 genes on the R1 plasmid, and these genes can be sorted into three different groups. The largest group, as seen in green in Figure 1, is the conjugative plasmid backbone. The region pictured in purple is primarily a Tn21-like transposon, and the smallest region pictured in yellow contains sequences resembling those of Klebsiella oxytoca.
Sources: en.wikipedia.org
No, it is a synthetic peptide fragment corresponding to a small portion of hGH. It is not the full 191-amino-acid hormone and does not reproduce all of hGH's effects.
It is commonly described as a 16-amino-acid peptide based on residues 176-191 of human growth hormone. Some sources vary in notation, so checking the stated sequence is useful.
It is not typically described as a standalone natural hormone. The sequence is derived from the C-terminal region of human growth hormone, but the synthetic peptide is a laboratory-made construct.
It is a synthetic peptide based on a C-terminal fragment of human growth hormone. It is commonly referred to as hGH fragment 176-191 and is studied for metabolic effects rather than growth effects.